The store will not work correctly when cookies are disabled.
NAA50
| Description | N-alpha-acetyltransferase 50 |
|---|
Gene and Protein Information
| Gene ID | 80218 |
|---|
| Uniprot Accession IDs | D3DN74 Q68DQ1 hNaa50p |
|---|
| Ensembl ID | ENSP00000240922 |
|---|
| Symbol | MAK3 NAT13 NAT5 SAN MAK3 NAT5 NAT13 NAT5P NAT13P hNaa50p |
|---|
| Family | Belongs to the acetyltransferase family. GNAT subfamily. |
|---|
| Sequence | MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 709764 | NAA50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 72117 | Naa50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 10090 | MGI:1919367 | Inparanoid, OMA, EggNOG |
| Rat | 288108 | Naa50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 10116 | RGD:1310944 | Inparanoid, OMA |
| Rat | | AABR07034273.1 | - | 10116 | | OMA, EggNOG |
| Horse | 100071372 | NAA50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 517211 | NAA50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 9913 | VGNC:53590 | Inparanoid, OMA, EggNOG |
| Pig | 100513438 | NAA50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100013194 | NAA50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100086792 | NAA50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 9258 | | Inparanoid, OMA |
| Anole lizard | 100554642 | naa50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 496547 | naa50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 8364 | XB-GENE-996002 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445229 | naa50 | N(alpha)-acetyltransferase 50, NatE catalytic subunit | 7955 | ZDB-GENE-040801-142 | Inparanoid, OMA, EggNOG |
| Fruitfly | 44724 | san | separation anxiety | 7227 | FBgn0024188 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
