The store will not work correctly when cookies are disabled.
Protein or Target Summary
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
| Gene ID | 58190 |
|---|
| uniprot | Q9GZU7 |
|---|
| Gene Name | CTDSP1 |
|---|
| Ensernbl ID | ENSP00000273062 |
|---|
| Sequence | MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 58190 | CTDSP1 | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 | Q9GZU7 |
| MOUSE | 227292 | Ctdsp1 | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 | P58466 |
| MOUSE | | Ctdsp1 | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 | F7AIT6 |
| MOUSE | 227292 | Ctdsp1 | CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 | Q5I0X8 |
| RAT | 363249 | Ctdsp1 | CTD small phosphatase 1 | B1WC24 |
| RAT | | Ctdsp1 | Ctdsp1 protein | Q3B8P1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
