The store will not work correctly when cookies are disabled.
Protein or Target Summary
Cytotoxic T-lymphocyte protein 4
| Gene ID | 1493 |
|---|
| uniprot | P16410 |
|---|
| Gene Name | CTLA4 |
|---|
| Ensernbl ID | ENSP00000303939 |
|---|
| Sequence | MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1493 | CTLA4 | Cytotoxic T-lymphocyte protein 4 | P16410 |
| MOUSE | 12477 | Ctla4 | Cytotoxic T-lymphocyte protein 4 | P09793 |
| MOUSE | | Ctla4 | CTLA-4 | Q9Z1A8 |
| MOUSE | | Ctla4 | Cytotoxic T-lymphocyte-associated protein 4 | Q7TMX1 |
| MOUSE | | Ctla4 | Uncharacterized protein ctla-4 | Q8CH94 |
| MOUSE | 12477 | Ctla4 | Cytotoxic T-lymphocyte protein 4 | Q5SSM0 |
| MOUSE | 12477 | Ctla4 | Cytotoxic T-lymphocyte protein 4 | Q6GTR6 |
| RAT | 63835 | Ctla4 | Cytotoxic T-lymphocyte associated protein-4 | Q62859 |
| RAT | 63835 | Ctla4 | Cytotoxic T-lymphocyte-associated protein 4 | G3V7D2 |
| RAT | | Ctla4 | Cytotoxic T-lymphocyte-associated protein 4 | A0A096MJE4 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
