The store will not work correctly when cookies are disabled.
CST7
Gene and Protein Information
| Gene ID | 8530 |
|---|
| Uniprot Accession IDs | Q6FH95 Q7Z4J8 Q9UED4 |
|---|
| Ensembl ID | ENSP00000420384 |
|---|
| Symbol | CMAP |
|---|
| Family | Belongs to the cystatin family. |
|---|
| Sequence | MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 740962 | CST7 | cystatin F | 9598 | VGNC:13840 | OMA, EggNOG |
| Macaque | 704850 | CST7 | cystatin F | 9544 | | Inparanoid, OMA |
| Mouse | 13011 | Cst7 | cystatin F (leukocystatin) | 10090 | MGI:1298217 | Inparanoid, OMA, EggNOG |
| Rat | 296257 | Cst7 | cystatin F | 10116 | RGD:1309154 | Inparanoid, OMA, EggNOG |
| Dog | 485563 | CST7 | cystatin F | 9615 | VGNC:39679 | Inparanoid, OMA, EggNOG |
| Horse | 100630051 | CST7 | cystatin F | 9796 | VGNC:16917 | Inparanoid, OMA, EggNOG |
| Cow | 617799 | CST7 | cystatin F | 9913 | VGNC:27777 | Inparanoid, OMA, EggNOG |
| Pig | 100152012 | CST7 | cystatin F | 9823 | | Inparanoid, OMA, EggNOG |
| Chicken | 416716 | CST7 | cystatin F | 9031 | CGNC:6573 | Inparanoid, OMA, EggNOG |
| Xenopus | 496776 | cst7 | cystatin F | 8364 | XB-GENE-945286 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
