Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CA5A

DescriptionCarbonic anhydrase 5A, mitochondrial

Gene and Protein Information

Gene ID763
Uniprot Accession IDs B2RPF2
Ensembl ID ENSP00000309649
Symbol CA5 CA5 CAV CAVA CA5AD GS1-21A4.1
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp468095CA5Acarbonic anhydrase 5A9598VGNC:9075OMA, EggNOG
Mouse12352Car5acarbonic anhydrase 5a, mitochondrial10090MGI:101946Inparanoid, OMA, EggNOG
Rat54233Car5acarbonic anhydrase 5A10116RGD:2243Inparanoid, OMA, EggNOG
Dog609174CA5Acarbonic anhydrase 5A9615VGNC:53312Inparanoid, OMA, EggNOG
Horse100070642CA5Acarbonic anhydrase 5A9796VGNC:49304Inparanoid, OMA, EggNOG
Cow515359CA5Acarbonic anhydrase 5A9913VGNC:50002Inparanoid, OMA, EggNOG
Opossum100025662CA5Acarbonic anhydrase 5A13616Inparanoid, EggNOG
PlatypusCA5Acarbonic anhydrase 5A [Source:HGNC Symbol;Acc:HGNC:1377]9258OMA, EggNOG

Associated Recombinant Proteins

The page will load shortly, Thanks for your patience!
NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!