The store will not work correctly when cookies are disabled.
CA5A
| Description | Carbonic anhydrase 5A, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 763 |
|---|
| Uniprot Accession IDs | B2RPF2 |
|---|
| Ensembl ID | ENSP00000309649 |
|---|
| Symbol | CA5 CA5 CAV CAVA CA5AD GS1-21A4.1 |
|---|
| Family | Belongs to the alpha-carbonic anhydrase family. |
|---|
| Sequence | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 468095 | CA5A | carbonic anhydrase 5A | 9598 | VGNC:9075 | OMA, EggNOG |
| Mouse | 12352 | Car5a | carbonic anhydrase 5a, mitochondrial | 10090 | MGI:101946 | Inparanoid, OMA, EggNOG |
| Rat | 54233 | Car5a | carbonic anhydrase 5A | 10116 | RGD:2243 | Inparanoid, OMA, EggNOG |
| Dog | 609174 | CA5A | carbonic anhydrase 5A | 9615 | VGNC:53312 | Inparanoid, OMA, EggNOG |
| Horse | 100070642 | CA5A | carbonic anhydrase 5A | 9796 | VGNC:49304 | Inparanoid, OMA, EggNOG |
| Cow | 515359 | CA5A | carbonic anhydrase 5A | 9913 | VGNC:50002 | Inparanoid, OMA, EggNOG |
| Opossum | 100025662 | CA5A | carbonic anhydrase 5A | 13616 | | Inparanoid, EggNOG |
| Platypus | | CA5A | carbonic anhydrase 5A [Source:HGNC Symbol;Acc:HGNC:1377] | 9258 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
