The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
CA5A
Description | Carbonic anhydrase 5A, mitochondrial |
---|
Gene and Protein Information
Gene ID | 763 |
Uniprot Accession IDs | B2RPF2 |
Ensembl ID | ENSP00000309649 |
Symbol | CA5 CA5 CAV CAVA CA5AD GS1-21A4.1 |
Family | Belongs to the alpha-carbonic anhydrase family. |
Sequence | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 468095 | CA5A | carbonic anhydrase 5A | 9598 | VGNC:9075 | OMA, EggNOG |
Mouse | 12352 | Car5a | carbonic anhydrase 5a, mitochondrial | 10090 | MGI:101946 | Inparanoid, OMA, EggNOG |
Rat | 54233 | Car5a | carbonic anhydrase 5A | 10116 | RGD:2243 | Inparanoid, OMA, EggNOG |
Dog | 609174 | CA5A | carbonic anhydrase 5A | 9615 | VGNC:53312 | Inparanoid, OMA, EggNOG |
Horse | 100070642 | CA5A | carbonic anhydrase 5A | 9796 | VGNC:49304 | Inparanoid, OMA, EggNOG |
Cow | 515359 | CA5A | carbonic anhydrase 5A | 9913 | VGNC:50002 | Inparanoid, OMA, EggNOG |
Opossum | 100025662 | CA5A | carbonic anhydrase 5A | 13616 | | Inparanoid, EggNOG |
Platypus | | CA5A | carbonic anhydrase 5A [Source:HGNC Symbol;Acc:HGNC:1377] | 9258 | | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!