The store will not work correctly when cookies are disabled.
Protein or Target Summary
Calcineurin subunit B type 2
| Gene ID | 5535 |
|---|
| uniprot | Q96LZ3 |
|---|
| Gene Name | PPP3R2 |
|---|
| Ensernbl ID | ENSP00000363939 |
|---|
| Family | Belongs to the calcineurin regulatory subunit family. |
|---|
| Sequence | MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5535 | PPP3R2 | Calcineurin subunit B type 2 | Q96LZ3 |
| MOUSE | 19059 | Ppp3r2 | Protein phosphatase 3, regulatory subunit B, alpha isoform (Calcineurin B, type II) | Q497S1 |
| MOUSE | 19059 | Ppp3r2 | Calcineurin subunit B type 2 | Q63811 |
| RAT | 29749 | Ppp3r2 | Calcineurin subunit B type 2 | P28470 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
