CTSZ
| Description | Cathepsin Z |
|---|
Gene and Protein Information
| Gene ID | 1522 |
|---|---|
| Uniprot Accession IDs | B2RC40 O75331 Q9UQV5 Q9UQV6 |
| Ensembl ID | ENSP00000217131 |
| Symbol | CTSX |
| Family | Belongs to the peptidase C1 family. |
| Sequence | MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 736240 | CTSZ | cathepsin Z | 9598 | VGNC:6087 | OMA, EggNOG |
| Macaque | 694157 | CTSZ | cathepsin Z | 9544 | OMA, EggNOG | |
| Mouse | 64138 | Ctsz | cathepsin Z | 10090 | MGI:1891190 | Inparanoid, OMA, EggNOG |
| Rat | 252929 | Ctsz | cathepsin Z | 10116 | RGD:708479 | Inparanoid, OMA, EggNOG |
| Dog | 611983 | CTSZ | cathepsin Z | 9615 | VGNC:39717 | Inparanoid, OMA, EggNOG |
| Horse | 100056600 | CTSZ | cathepsin Z | 9796 | VGNC:16957 | Inparanoid, OMA, EggNOG |
| Cow | 404187 | CTSZ | cathepsin Z | 9913 | VGNC:27820 | Inparanoid, OMA, EggNOG |
| Pig | 100141405 | CTSZ | cathepsin Z | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100027054 | CTSZ | cathepsin Z | 13616 | Inparanoid, EggNOG | |
| Chicken | 419311 | CTSZ | cathepsin Z | 9031 | CGNC:5626 | Inparanoid, OMA, EggNOG |
| Xenopus | 100127597 | ctsz | cathepsin Z | 8364 | XB-GENE-959211 | Inparanoid, OMA, EggNOG |
| Zebrafish | 450022 | ctsz | cathepsin Z | 7955 | ZDB-GENE-041010-139 | Inparanoid, OMA, EggNOG |
| C. elegans | 171829 | cpz-1 | CathePsin Z | 6239 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / protease inhibitor / Cathepsin Z
protein / cysteine protease / Cathepsin Z
protein / protease / Cathepsin Z
protein / hydrolase / Cathepsin Z
protein / protease inhibitor / Cathepsin Z
protein / cysteine protease / Cathepsin Z
protein / protease / Cathepsin Z
protein / hydrolase / Cathepsin Z
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|