JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Chromobox protein homolog 3

Gene ID	11335
uniprot	Q13185
Gene Name	CBX3
Ensernbl ID	ENSP00000336687
Sequence	MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	11335	CBX3	Chromobox protein homolog 3	Q13185
MOUSE		Cbx3	Chromobox protein homolog 3	P23198
MOUSE	12417	Cbx3	Chromobox homolog 3 (Drosophila HP1 gamma)	Q32P00
MOUSE		Cbx3	Chromobox protein homolog 3	D3Z1A9
MOUSE		Cbx3	Cbx3 protein	I6L9I7
MOUSE		Cbx3	Chromobox protein homolog 3	D3Z313
MOUSE	12417	Cbx3	Cbx3 protein	Q9DCC5
RAT	297093	Cbx3	Chromobox 3	Q5RJK5
RAT		Cbx3	Cbx3 protein	Q5RJL1

Protein Classes

DTO Classes
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Chromodomain / Chromobox protein homolog 3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx