The store will not work correctly when cookies are disabled.
CCL4L1
| Description | C-C motif chemokine 4-like |
|---|
Gene and Protein Information
| Gene ID | 388372 |
|---|
| Uniprot Accession IDs | B2RUZ3 B7ZMA8 Q50EM1 Q50EM2 Q50EM3 Q50EM4 Q50EM5 Q50EM6 Q50EM7 Q50EM8 Q569J2 Q6NSB0 |
|---|
| Ensembl ID | ENSP00000483609 |
|---|
| Symbol | CCL4L LAG1 SCYA4L1 LAG1 CCL4L LAG-1 SCYA4L AT744.2 SCYA4L1 SCYA4L2 MIP-1-beta |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
