The store will not work correctly when cookies are disabled.
CCNB1
Description | G2/mitotic-specific cyclin-B1 |
---|
Gene and Protein Information
Gene ID | 891 |
Uniprot Accession IDs | A8K066 Q5TZP9 |
Ensembl ID | ENSP00000256442 |
Symbol | CCNB CCNB |
Family | Belongs to the cyclin family. Cyclin AB subfamily. |
Sequence | MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 461835 | CCNB1 | cyclin B1 | 9598 | VGNC:3935 | OMA, EggNOG |
Macaque | 699504 | CCNB1 | cyclin B1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 268697 | Ccnb1 | cyclin B1 | 10090 | MGI:88302 | Inparanoid, OMA, EggNOG |
Rat | 25203 | Ccnb1 | cyclin B1 | 10116 | RGD:2291 | Inparanoid, OMA |
Horse | 100050093 | CCNB1 | cyclin B1 | 9796 | VGNC:16204 | Inparanoid, OMA, EggNOG |
Cow | 327679 | CCNB1 | cyclin B1 | 9913 | VGNC:26958 | Inparanoid, OMA, EggNOG |
Pig | 397662 | CCNB1 | cyclin B1 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100019387 | CCNB1 | cyclin B1 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100083344 | CCNB1 | cyclin B1 | 9258 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100557278 | ccnb1 | cyclin B1 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 394726 | ccnb1.2 | cyclin B1 | 8364 | XB-GENE-5736422 | Inparanoid, OMA |
Zebrafish | 58025 | ccnb1 | cyclin B1 | 7955 | ZDB-GENE-000406-10 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|