CBX6

DescriptionChromobox protein homolog 6

Gene and Protein Information

Gene ID23466
Uniprot Accession IDs A8KAH0 Q96EM5
Ensembl ID ENSP00000384490
Sequence
MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse494448Cbx6chromobox 610090MGI:3512628Inparanoid, OMA, EggNOG
Rat315136Cbx6chromobox 610116RGD:1307314Inparanoid, OMA
Cow513830CBX6chromobox 69913VGNC:26819Inparanoid, OMA
OpossumCBX6chromobox 6 [Source:HGNC Symbol;Acc:HGNC:1556]13616Inparanoid, OMA, EggNOG
Xenopus549371cbx6chromobox 68364XB-GENE-951161Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 6

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source