JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

CBX6

Description	Chromobox protein homolog 6

Gene and Protein Information

Gene ID	23466
Uniprot Accession IDs	A8KAH0 Q96EM5
Ensembl ID	ENSP00000384490
Sequence	MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	494448	Cbx6	chromobox 6	10090	MGI:3512628	Inparanoid, OMA, EggNOG
Rat	315136	Cbx6	chromobox 6	10116	RGD:1307314	Inparanoid, OMA
Cow	513830	CBX6	chromobox 6	9913	VGNC:26819	Inparanoid, OMA
Opossum		CBX6	chromobox 6 [Source:HGNC Symbol;Acc:HGNC:1556]	13616		Inparanoid, OMA, EggNOG
Xenopus	549371	cbx6	chromobox 6	8364	XB-GENE-951161	Inparanoid, OMA

Protein Classes

DTO Classes
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Chromodomain / Chromobox protein homolog 6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]