Protein or Target Summary
Cyclin-dependent kinase 9
| Gene ID | 1025 |
|---|---|
| uniprot | P50750 |
| Gene Name | CDK9 |
| Ensernbl ID | ENSP00000362361 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 1025 | CDK9 | Cyclin-dependent kinase 9 | P50750 |
| MOUSE | 107951 | Cdk9 | Cyclin-dependent kinase 9 | Q99J95 |
| MOUSE | Cdk9 | Cyclin-dependent kinase 9 | D6RHP4 | |
| MOUSE | Cdk9 | Cyclin-dependent kinase 9 | D6RGN3 | |
| MOUSE | Cdk9 | Cyclin-dependent kinase 9 | B0R021 | |
| RAT | 362110 | Cdk9 | Cyclin-dependent kinase 9 | Q641Z4 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 9
protein / protein kinase / Cyclin-dependent kinase 9
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 9
protein / transferase / Cyclin-dependent kinase 9
protein / kinase / Cyclin-dependent kinase 9
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 9
protein / protein kinase / Cyclin-dependent kinase 9
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 9
protein / transferase / Cyclin-dependent kinase 9
protein / kinase / Cyclin-dependent kinase 9
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK9 subfamily / Cyclin-dependent kinase 9
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK9 subfamily / Cyclin-dependent kinase 9
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx