The store will not work correctly when cookies are disabled.
Protein or Target Summary
Complement C1q subcomponent subunit B
| Gene ID | 713 |
|---|
| uniprot | P02746 |
|---|
| Gene Name | C1QB |
|---|
| Ensernbl ID | ENSP00000313967 |
|---|
| Sequence | MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 713 | C1QB | Complement C1q subcomponent subunit B | P02746 |
| MOUSE | | C1qb | Uncharacterized protein | Q3US82 |
| MOUSE | | C1qb | Uncharacterized protein | Q3U6I5 |
| MOUSE | 12260 | C1qb | Complement C1q subcomponent subunit B | P14106 |
| RAT | | C1qb | Adiponectin a | G3V7N9 |
| RAT | 29687 | C1qb | Complement C1q subcomponent subunit B | P31721 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
