| Description | Cathepsin S |
|---|
Gene and Protein Information
| Gene ID | 1520 |
|---|---|
| Uniprot Accession IDs | B4DWC9 D3DV05 Q5T5I0 Q6FHS5 Q9BUG3 |
| Ensembl ID | ENSP00000357981 |
| Family | Belongs to the peptidase C1 family. |
| Sequence | MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457277 | CTSS | cathepsin S | 9598 | VGNC:516 | OMA, EggNOG |
| Macaque | 708080 | CTSS | cathepsin S | 9544 | OMA, EggNOG | |
| Mouse | 13040 | Ctss | cathepsin S | 10090 | MGI:107341 | Inparanoid, OMA, EggNOG |
| Rat | 50654 | Ctss | cathepsin S | 10116 | RGD:621513 | Inparanoid, OMA |
| Dog | 403400 | CTSS | cathepsin S | 9615 | VGNC:39715 | Inparanoid, OMA, EggNOG |
| Horse | 100054948 | CTSS | cathepsin S | 9796 | VGNC:16955 | Inparanoid, OMA, EggNOG |
| Cow | 327711 | CTSS | cathepsin S | 9913 | VGNC:27818 | Inparanoid, OMA, EggNOG |
| Pig | 100153090 | CTSS | cathepsin S | 9823 | OMA, EggNOG | |
| Opossum | 100017406 | CTSS | cathepsin S | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CTSS | cathepsin S [Source:HGNC Symbol;Acc:HGNC:2545] | 9258 | OMA, EggNOG | ||
| Chicken | 425657 | CTSS | cathepsin S | 9031 | CGNC:494 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100560943 | ctss | cathepsin S | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448203 | ctss | cathepsin S | 8364 | XB-GENE-953011 | Inparanoid, OMA, EggNOG |
| Zebrafish | 337572 | ctss2.2 | cathepsin S, ortholog 2, tandem duplicate 2 | 7955 | ZDB-GENE-050626-55 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / protease inhibitor / Cathepsin S
protein / cysteine protease / Cathepsin S
protein / protease / Cathepsin S
protein / hydrolase / Cathepsin S
protein / protease inhibitor / Cathepsin S
protein / cysteine protease / Cathepsin S
protein / protease / Cathepsin S
protein / hydrolase / Cathepsin S
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|