Description	Cathepsin S

Gene and Protein Information

Gene ID	1520
Uniprot Accession IDs	B4DWC9 D3DV05 Q5T5I0 Q6FHS5 Q9BUG3
Ensembl ID	ENSP00000357981
Family	Belongs to the peptidase C1 family.
Sequence	MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI Show more

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1520	CTSS	Cathepsin S	P25774
MOUSE	13040	Ctss	Cathepsin S	O70370
MOUSE		Ctss	Uncharacterized protein	Q3U5K1
MOUSE	13040	Ctss	Uncharacterized protein	Q3UD32
MOUSE	13040	Ctss	Cathepsin S	F6WR04
MOUSE		Ctss	Ctss protein	Q99M14
MOUSE	13040	Ctss	Cathepsin S	Q8BSZ5
MOUSE		Ctss	Uncharacterized protein	Q3UBR4
RAT	50654	Ctss	Cathepsin S	Q02765
RAT		Ctss	Cathepsin S	D3ZZR3

Protein Classes

PANTHER Classes
protein    /    protease inhibitor    /    Cathepsin S
protein    /    cysteine protease    /    Cathepsin S
protein    /    protease    /    Cathepsin S
protein    /    hydrolase    /    Cathepsin S

DTO Classes
protein / Enzyme / Protease / Cysteine protease / Cathepsin S

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Related active small molecules

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

CTSS