Protein or Target Summary
G2/mitotic-specific cyclin-B2
| Gene ID | 9133 |
|---|---|
| uniprot | O95067 |
| Gene Name | CCNB2 |
| Ensernbl ID | ENSP00000288207 |
| Family | Belongs to the cyclin family. Cyclin AB subfamily. |
| Sequence | MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / G2/mitotic-specific cyclin-B2
protein / Enzyme modulator / Kinase modulator / Kinase activator / G2/mitotic-specific cyclin-B2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx