The store will not work correctly when cookies are disabled.
CD72
| Description | B-cell differentiation antigen CD72 |
|---|
Gene and Protein Information
| Gene ID | 971 |
|---|
| Uniprot Accession IDs | P21854 |
|---|
| Ensembl ID | ENSP00000379980 |
|---|
| Symbol | LYB2 CD72b |
|---|
| Sequence | MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 465075 | CD72 | CD72 molecule | 9598 | VGNC:4653 | OMA, EggNOG |
| Macaque | 100427076 | CD72 | CD72 molecule | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12517 | Cd72 | CD72 antigen | 10090 | MGI:88345 | Inparanoid, OMA |
| Rat | 313498 | Cd72 | Cd72 molecule | 10116 | RGD:1309757 | Inparanoid, OMA |
| Dog | 481595 | CD72 | CD72 molecule | 9615 | VGNC:38971 | Inparanoid, OMA, EggNOG |
| Horse | | CD72 | CD72 molecule [Source:HGNC Symbol;Acc:HGNC:1696] | 9796 | | OMA, EggNOG |
| Cow | 783725 | CD72 | CD72 molecule | 9913 | VGNC:27045 | Inparanoid, OMA, EggNOG |
| Pig | 100038011 | CD72 | CD72 molecule | 9823 | | Inparanoid, OMA, EggNOG |
| Chicken | 395923 | CD72 | CD72 molecule | 9031 | CGNC:49553 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
