The store will not work correctly when cookies are disabled.
CNPY1
| Description | Protein canopy homolog 1 |
|---|
Gene and Protein Information
| Gene ID | 285888 |
|---|
| Uniprot Accession IDs | A6NGX3 |
|---|
| Ensembl ID | ENSP00000317439 |
|---|
| Family | Belongs to the canopy family. |
|---|
| Sequence | MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANHTEL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 718795 | CNPY1 | canopy FGF signaling regulator 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 269637 | Cnpy1 | canopy FGF signaling regulator 1 | 10090 | MGI:2442451 | Inparanoid, OMA |
| Dog | 100856196 | CNPY1 | canopy FGF signaling regulator 1 | 9615 | VGNC:39423 | Inparanoid, OMA, EggNOG |
| Cow | 100336047 | CNPY1 | canopy FGF signaling regulator 1 | 9913 | VGNC:27526 | Inparanoid, OMA, EggNOG |
| Opossum | 100016456 | CNPY1 | canopy FGF signaling regulator 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100081821 | CNPY1 | canopy FGF signaling regulator 1 | 9258 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
