The store will not work correctly when cookies are disabled.
CYP24A1
| Description | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 1591 |
|---|
| Uniprot Accession IDs | Q15807 Q32ML3 Q5I2W7 24-OHase |
|---|
| Ensembl ID | ENSP00000216862 |
|---|
| Symbol | CYP24 CP24 HCAI CYP24 HCINF1 P450-CC24 |
|---|
| Family | Belongs to the cytochrome P450 family. |
|---|
| Sequence | MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 746729 | CYP24A1 | cytochrome P450 family 24 subfamily A member 1 | 9598 | VGNC:9835 | OMA, EggNOG |
| Macaque | 698937 | LOC698937 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | 9544 | | OMA, EggNOG |
| Mouse | 13081 | Cyp24a1 | cytochrome P450, family 24, subfamily a, polypeptide 1 | 10090 | MGI:88593 | Inparanoid, OMA, EggNOG |
| Rat | 25279 | Cyp24a1 | cytochrome P450, family 24, subfamily a, polypeptide 1 | 10116 | RGD:2462 | Inparanoid, OMA, EggNOG |
| Dog | 485935 | CYP24A1 | cytochrome P450 family 24 subfamily A member 1 | 9615 | VGNC:50338 | Inparanoid, OMA, EggNOG |
| Horse | 100053452 | CYP24A1 | cytochrome P450 family 24 subfamily A member 1 | 9796 | VGNC:50560 | Inparanoid, OMA, EggNOG |
| Cow | 540080 | CYP24A1 | cytochrome P450, family 24, subfamily A, polypeptide 1 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 397145 | CYP24A1 | cytochrome P450, family 24, subfamily A, polypeptide 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564552 | LOC100564552 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | 28377 | | OMA, EggNOG |
| Xenopus | 100497429 | cyp24a1 | cytochrome P450 family 24 subfamily A member 1 | 8364 | XB-GENE-479201 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100004700 | cyp24a1 | cytochrome P450, family 24, subfamily A, polypeptide 1 | 7955 | ZDB-GENE-060825-1 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
