Protein or Target Summary
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
Gene ID | 1591 |
---|---|
uniprot | Q07973 |
Gene Name | CYP24A1 |
Ensernbl ID | ENSP00000216862 |
Family | Belongs to the cytochrome P450 family. |
Sequence | MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 1591 | CYP24A1 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | Q07973 |
MOUSE | 13081 | Cyp24a1 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | Q64441 |
MOUSE | Cyp24a1 | Uncharacterized protein | Q3TXU0 | |
MOUSE | Cyp24a1 | Uncharacterized protein | Q3TP55 | |
MOUSE | Cyp24a1 | Uncharacterized protein | Q3TWZ8 | |
MOUSE | 13081 | Cyp24a1 | Cytochrome P450, family 24, subfamily a, polypeptide 1 | Q3TWW0 |
RAT | 25279 | Cyp24a1 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | Q09128 |
Protein Classes
PANTHER Classes
protein / oxidoreductase / oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
protein / oxidoreductase / oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
protein / Enzyme / Oxidoreductase / Oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx