Protein or Target Summary
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
| Gene ID | 1591 |
|---|---|
| uniprot | Q07973 |
| Gene Name | CYP24A1 |
| Ensernbl ID | ENSP00000216862 |
| Family | Belongs to the cytochrome P450 family. |
| Sequence | MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 1591 | CYP24A1 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | Q07973 |
| MOUSE | 13081 | Cyp24a1 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | Q64441 |
| MOUSE | Cyp24a1 | Uncharacterized protein | Q3TXU0 | |
| MOUSE | Cyp24a1 | Uncharacterized protein | Q3TP55 | |
| MOUSE | Cyp24a1 | Uncharacterized protein | Q3TWZ8 | |
| MOUSE | 13081 | Cyp24a1 | Cytochrome P450, family 24, subfamily a, polypeptide 1 | Q3TWW0 |
| RAT | 25279 | Cyp24a1 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | Q09128 |
Protein Classes
PANTHER Classes
protein / oxidoreductase / oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
protein / oxidoreductase / oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
protein / Enzyme / Oxidoreductase / Oxygenase / 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx