The store will not work correctly when cookies are disabled.
CCL17
| Description | C-C motif chemokine 17 |
|---|
Gene and Protein Information
| Gene ID | 6361 |
|---|
| Uniprot Accession IDs | A0N0Q9 Q2M287 |
|---|
| Ensembl ID | ENSP00000219244 |
|---|
| Symbol | SCYA17 TARC TARC ABCD-2 SCYA17 A-152E5.3 |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 574180 | CCL17 | C-C motif chemokine ligand 17 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20295 | Ccl17 | chemokine (C-C motif) ligand 17 | 10090 | MGI:1329039 | Inparanoid, OMA, EggNOG |
| Rat | 117518 | Ccl17 | C-C motif chemokine ligand 17 | 10116 | RGD:619924 | Inparanoid, OMA, EggNOG |
| Dog | 403586 | CCL17 | C-C motif chemokine ligand 17 | 9615 | VGNC:38882 | Inparanoid, OMA, EggNOG |
| Horse | 100630824 | CCL17 | C-C motif chemokine ligand 17 | 9796 | VGNC:51150 | Inparanoid, OMA, EggNOG |
| Cow | 100140488 | CCL17 | C-C motif chemokine ligand 17 | 9913 | VGNC:26945 | Inparanoid, OMA, EggNOG |
| Pig | 780408 | CCL17 | C-C motif chemokine ligand 17 | 9823 | | Inparanoid, OMA, EggNOG |
| Platypus | 103171076 | CCL17 | C-C motif chemokine ligand 17 | 9258 | | OMA, EggNOG |
| Chicken | 415652 | CCL17 | C-C motif chemokine ligand 17 | 9031 | CGNC:17397 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
