JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

CD48 antigen

Gene ID	962
uniprot	P09326
Gene Name	CD48
Ensernbl ID	ENSP00000484431
Sequence	MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	962	CD48	CD48 antigen	P09326
MOUSE	12506	Cd48	CD48 antigen	P18181
MOUSE		Cd48	CD48 antigen	Q6P905
MOUSE		Cd48	CD48 antigen	F8WHM0
MOUSE		Cd48	Uncharacterized protein	Q3UK50
MOUSE		Cd48	CD48	Q18PH8
MOUSE		Cd48	CD48 antigen, isoform CRA_c	Q8C2T1
RAT	245962	Cd48	CD48 antigen	P10252

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx