Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

CD70 antigen

Gene ID970
uniprotP32970
Gene NameCD70
Ensernbl IDENSP00000245903
FamilyBelongs to the tumor necrosis factor family.
Sequence
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN970CD70CD70 antigenP32970
MOUSE21948Cd70CD70 antigenO55237
MOUSE21948Cd70CD70 antigenQ05A52
RATCd70Cd70 moleculeM0R613

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source