Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

CD276

DescriptionCD276 antigen

Gene and Protein Information

Gene ID80381
Uniprot Accession IDs Q6P5Y4 Q6UXI2 Q8NBI8 Q8NC34 Q8NCB6 Q9BXR1
Ensembl ID ENSP00000320084
Symbol B7H3 B7H3 B7-H3 B7RP-2 4Ig-B7-H3
FamilyBelongs to the immunoglobulin superfamily. BTN/MOG family.
Sequence
MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467818CD276CD276 molecule9598VGNC:3569OMA, EggNOG
Macaque699877CD276CD276 molecule9544Inparanoid, OMA, EggNOG
Mouse102657Cd276CD276 antigen10090MGI:2183926Inparanoid, EggNOG
Rat315716Cd276Cd276 molecule10116RGD:727815Inparanoid, EggNOG
Dog487638CD276CD276 molecule9615VGNC:38943Inparanoid, OMA, EggNOG
Horse100052046CD276CD276 molecule9796VGNC:50583Inparanoid, EggNOG
Cow508656CD276CD276 molecule9913VGNC:27020Inparanoid, OMA, EggNOG
Anole lizard100560938cd276CD276 molecule28377Inparanoid, EggNOG
Xenopus100101669cd276CD276 molecule8364XB-GENE-921537Inparanoid, EggNOG
Zebrafish791140cd276CD276 molecule7955ZDB-GENE-070112-452Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    protease inhibitor    /    CD276 antigen
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    CD276 antigen

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.