The store will not work correctly when cookies are disabled.
Protein or Target Summary
T-cell surface glycoprotein CD8 alpha chain
| Gene ID | 925 |
|---|
| uniprot | P01732 |
|---|
| Gene Name | CD8A |
|---|
| Ensernbl ID | ENSP00000386559 |
|---|
| Sequence | MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 925 | CD8A | T-cell surface glycoprotein CD8 alpha chain | P01732 |
| MOUSE | 12525 | Cd8a | T-cell surface glycoprotein CD8 alpha chain | P01731 |
| MOUSE | | Cd8a | Uncharacterized protein | Q8C2L1 |
| MOUSE | | Cd8a | CD8 | Q60965 |
| MOUSE | | Cd8a | Cd8a protein | Q8K2M2 |
| MOUSE | | Cd8a | Uncharacterized protein | Q3UUV7 |
| MOUSE | | Cd8a | Uncharacterized protein | Q542K6 |
| MOUSE | | Cd8a | Uncharacterized protein | Q8C2Q0 |
| MOUSE | 12525 | Cd8a | MCG127285, isoform CRA_a | Q8CAX3 |
| RAT | 24930 | Cd8a | T-cell surface glycoprotein CD8 alpha chain | P07725 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
