The store will not work correctly when cookies are disabled.
CD8A
| Description | T-cell surface glycoprotein CD8 alpha chain |
|---|
Gene and Protein Information
| Gene ID | 925 |
|---|
| Uniprot Accession IDs | B4DT80 D6W5M8 Q13970 Q4ZG17 |
|---|
| Ensembl ID | ENSP00000386559 |
|---|
| Symbol | MAL CD8 p32 Leu2 |
|---|
| Sequence | MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 735755 | CD8A | CD8a molecule | 9598 | VGNC:188 | OMA, EggNOG |
| Macaque | 698329 | CD8A | CD8a molecule | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12525 | Cd8a | CD8 antigen, alpha chain | 10090 | MGI:88346 | Inparanoid, OMA, EggNOG |
| Rat | 24930 | Cd8a | CD8a molecule | 10116 | RGD:2316 | Inparanoid, OMA, EggNOG |
| Dog | 403157 | CD8A | CD8a molecule | 9615 | VGNC:38980 | Inparanoid, OMA, EggNOG |
| Horse | 100066774 | CD8A | CD8a molecule | 9796 | VGNC:16282 | Inparanoid, OMA, EggNOG |
| Cow | 281060 | CD8A | CD8a molecule | 9913 | VGNC:27052 | Inparanoid, OMA, EggNOG |
| Pig | 396627 | CD8A | CD8a molecule | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100029709 | CD8A | CD8a molecule | 13616 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
