The store will not work correctly when cookies are disabled.
CCL14
| Description | C-C motif chemokine 14 |
|---|
Gene and Protein Information
| Gene ID | 6358 |
|---|
| Uniprot Accession IDs | E1P649 E1P650 Q13954 |
|---|
| Ensembl ID | ENSP00000479097 |
|---|
| Symbol | NCC2 SCYA14 CC-1 CC-3 CKB1 MCIF NCC2 SY14 HCC-1 HCC-3 NCC-2 SCYL2 SCYA14 HCC-1(1-74) HCC-1/HCC-3 |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Dog | 480603 | CCL14 | C-C motif chemokine ligand 14 | 9615 | VGNC:52020 | Inparanoid, OMA |
| Cow | 616723 | CCL14 | chemokine (C-C motif) ligand 14 | 9913 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
