The store will not work correctly when cookies are disabled.
CCL5
| Description | C-C motif chemokine 5 |
|---|
Gene and Protein Information
| Gene ID | 6352 |
|---|
| Uniprot Accession IDs | O43646 Q0QVW8 Q4ZGJ1 Q9NYA2 Q9UBG2 Q9UC99 |
|---|
| Ensembl ID | ENSP00000474412 |
|---|
| Symbol | D17S136E SCYA5 SISd eoCP SCYA5 RANTES TCP228 D17S136E SIS-delta |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
