Protein or Target Summary
Cell division control protein 42 homolog
| Gene ID | 998 |
|---|---|
| uniprot | P60953 |
| Gene Name | CDC42 |
| Ensernbl ID | ENSP00000383118 |
| Family | Belongs to the small GTPase superfamily. Rho family. CDC42 subfamily. |
| Sequence | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 998 | CDC42 | Cell division control protein 42 homolog | P60953 |
| MOUSE | 12540 | Cdc42 | Cell division control protein 42 homolog | P60766 |
| MOUSE | Cdc42 | Cell division cycle protein CDC42 | Q99JI7 | |
| MOUSE | Cdc42 | Uncharacterized protein | Q3UL78 | |
| RAT | 64465 | Cdc42 | Cell division control protein 42 homolog | Q8CFN2 |
| RAT | 64465 | Cdc42 | Cell division control protein 42 homolog | A0A0G2JSM8 |
Protein Classes
PANTHER Classes
protein / enzyme modulator / small GTPase / Cell division control protein 42 homolog
protein / enzyme modulator / small GTPase / Cell division control protein 42 homolog
DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Cell division control protein 42 homolog
protein / Enzyme modulator / G-protein / Small GTPase / Cell division control protein 42 homolog
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx