CDC42

Description	Cell division control protein 42 homolog

Gene and Protein Information

Gene ID	998
Uniprot Accession IDs	P21181 P25763 Q7L8R5 Q9UDI2
Ensembl ID	ENSP00000383118
Symbol	TKS G25K CDC42Hs
Family	Belongs to the small GTPase superfamily. Rho family. CDC42 subfamily.
Sequence	MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	707637	CDC42	cell division cycle 42	9544		OMA, EggNOG
Mouse	12540	Cdc42	cell division cycle 42	10090	MGI:106211	Inparanoid, OMA, EggNOG
Rat	64465	Cdc42	cell division cycle 42	10116	RGD:71043	Inparanoid, OMA, EggNOG
Dog	403934	CDC42	cell division cycle 42	9615		Inparanoid, OMA, EggNOG
Horse	100058188	CDC42	cell division cycle 42	9796		Inparanoid, OMA, EggNOG
Pig	780428	CDC42	cell division cycle 42	9823		Inparanoid, OMA, EggNOG
Opossum	100023099	CDC42	cell division cycle 42	13616		Inparanoid, OMA, EggNOG
Chicken	395917	CDC42	cell division cycle 42	9031	CGNC:3561	Inparanoid, OMA
Xenopus	493389	cdc42	cell division cycle 42	8364	XB-GENE-967585	Inparanoid, OMA, EggNOG
Zebrafish	336839	cdc42	cell division cycle 42	7955	ZDB-GENE-030131-8783	Inparanoid, OMA
Fruitfly	32981	Cdc42	CG12530 gene product from transcript CG12530-RC	7227	FBgn0010341	Inparanoid, EggNOG
S.cerevisiae	850930	CDC42	Rho family GTPase CDC42	4932	S000004219	Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / small GTPase / Cell division control protein 42 homolog

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Cell division control protein 42 homolog

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source