Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CDK4

DescriptionCyclin-dependent kinase 4

Gene and Protein Information

Gene ID1019
Uniprot Accession IDs P11802 B2R9A0 B4DNF9 O00576 Q6FG61
Ensembl ID ENSP00000257904
Symbol CMM3 PSK-J3
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452025CDK4cyclin dependent kinase 49598VGNC:8366OMA, EggNOG
Macaque715650CDK4cyclin dependent kinase 49544Inparanoid, OMA, EggNOG
Mouse12567Cdk4cyclin-dependent kinase 410090MGI:88357Inparanoid, OMA, EggNOG
Rat94201Cdk4cyclin-dependent kinase 410116RGD:621120Inparanoid, OMA, EggNOG
Dog481131CDK4cyclin dependent kinase 49615VGNC:39054Inparanoid, OMA
Horse100051005CDK4cyclin dependent kinase 49796VGNC:16348Inparanoid, OMA
Cow510618CDK4cyclin dependent kinase 49913Inparanoid, OMA
Pig100144492CDK4cyclin dependent kinase 49823Inparanoid, OMA
Anole lizard100559515cdk4cyclin dependent kinase 428377Inparanoid, OMA
Zebrafish777730cdk4cyclin-dependent kinase 47955ZDB-GENE-060929-974Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    non-receptor serine/threonine protein kinase    /    Cyclin-dependent kinase 4
protein    /    protein kinase    /    Cyclin-dependent kinase 4
protein    /    non-receptor tyrosine protein kinase    /    Cyclin-dependent kinase 4
protein    /    transferase    /    Cyclin-dependent kinase 4
protein    /    kinase    /    Cyclin-dependent kinase 4
DTO Classes
protein    /    Kinase    /    Protein kinase    /    CMGC group    /    CDK family    /    CDK4 subfamily    /    Cyclin-dependent kinase 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Zhang, J M JM, Wei, Q Q, Zhao, X X and Paterson, B M BM. 1999-02-15 Coupling of the cell cycle and myogenesis through the cyclin D1-dependent interaction of MyoD with cdk4. [PMID:10022835]
      2.Zhang, Q Q, Wang, X X and Wolgemuth, D J DJ. 1999-06 Developmentally regulated expression of cyclin D3 and its potential in vivo interacting proteins during murine gametogenesis. [PMID:10342870]
      3.van der Kuip, H H and 5 more authors. 1999-04 The DNA-binding subunit p140 of replication factor C is upregulated in cycling cells and associates with G1 phase cell cycle regulatory proteins. [PMID:10353443]
      4.Harbour, J W JW, Luo, R X RX, Dei Santi, A A, Postigo, A A AA and Dean, D C DC. 1999-09-17 Cdk phosphorylation triggers sequential intramolecular interactions that progressively block Rb functions as cells move through G1. [PMID:10499802]
      5.Sugimoto, M M and 10 more authors. 1999-11-15 Regulation of CDK4 activity by a novel CDK4-binding protein, p34(SEI-1). [PMID:10580009]
      6.Zhang, J M JM, Zhao, X X, Wei, Q Q and Paterson, B M BM. 1999-12-15 Direct inhibition of G(1) cdk kinase activity by MyoD promotes myoblast cell cycle withdrawal and terminal differentiation. [PMID:10601020]
      7.Ikematsu, N N and 7 more authors. 1999-12-09 Tob2, a novel anti-proliferative Tob/BTG1 family member, associates with a component of the CCR4 transcriptional regulatory complex capable of binding cyclin-dependent kinases. [PMID:10602502]
      8.Nekhai, S S, Shukla, R R RR, Fernandez, A A, Kumar, A A and Lamb, N J NJ. 2000-01-20 Cell cycle-dependent stimulation of the HIV-1 promoter by Tat-associated CAK activator. [PMID:10639311]
      9.Suzuki, A A and 9 more authors. 2000-03-02 Survivin initiates procaspase 3/p21 complex formation as a result of interaction with Cdk4 to resist Fas-mediated cell death. [PMID:10713676]
      10.Pahl, P M PM and 5 more authors. 2000-06-09 An exochelin of Mycobacterium tuberculosis reversibly arrests growth of human vascular smooth muscle cells in vitro. [PMID:10748174]