CDK4
| Description | Cyclin-dependent kinase 4 |
|---|
Gene and Protein Information
| Gene ID | 1019 |
|---|---|
| Uniprot Accession IDs | B2R9A0 B4DNF9 O00576 Q6FG61 |
| Ensembl ID | ENSP00000257904 |
| Symbol | CMM3 PSK-J3 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452025 | CDK4 | cyclin dependent kinase 4 | 9598 | VGNC:8366 | OMA, EggNOG |
| Macaque | 715650 | CDK4 | cyclin dependent kinase 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12567 | Cdk4 | cyclin-dependent kinase 4 | 10090 | MGI:88357 | Inparanoid, OMA, EggNOG |
| Rat | 94201 | Cdk4 | cyclin-dependent kinase 4 | 10116 | RGD:621120 | Inparanoid, OMA, EggNOG |
| Dog | 481131 | CDK4 | cyclin dependent kinase 4 | 9615 | VGNC:39054 | Inparanoid, OMA |
| Horse | 100051005 | CDK4 | cyclin dependent kinase 4 | 9796 | VGNC:16348 | Inparanoid, OMA |
| Cow | 510618 | CDK4 | cyclin dependent kinase 4 | 9913 | Inparanoid, OMA | |
| Pig | 100144492 | CDK4 | cyclin dependent kinase 4 | 9823 | Inparanoid, OMA | |
| Anole lizard | 100559515 | cdk4 | cyclin dependent kinase 4 | 28377 | Inparanoid, OMA | |
| Zebrafish | 777730 | cdk4 | cyclin-dependent kinase 4 | 7955 | ZDB-GENE-060929-974 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 4
protein / protein kinase / Cyclin-dependent kinase 4
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 4
protein / transferase / Cyclin-dependent kinase 4
protein / kinase / Cyclin-dependent kinase 4
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 4
protein / protein kinase / Cyclin-dependent kinase 4
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 4
protein / transferase / Cyclin-dependent kinase 4
protein / kinase / Cyclin-dependent kinase 4
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK4 subfamily / Cyclin-dependent kinase 4
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK4 subfamily / Cyclin-dependent kinase 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|