Protein or Target Summary
Cyclin-dependent kinase 18
| Gene ID | 5129 |
|---|---|
| uniprot | Q07002 |
| Gene Name | CDK18 |
| Ensernbl ID | ENSP00000423665 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5129 | CDK18 | Cyclin-dependent kinase 18 | Q07002 |
| MOUSE | 18557 | Cdk18 | Cyclin-dependent kinase 18 | Q04899 |
| MOUSE | Cdk18 | Pctk3 protein | Q0VDL5 | |
| MOUSE | Cdk18 | Cyclin-dependent kinase 18 | A0A087WQ42 | |
| MOUSE | 18557 | Cdk18 | PCTAIRE-motif protein kinase 3 | Q0VDL6 |
| RAT | 289019 | Cdk18 | Cyclin-dependent kinase 18 | A0A0H2UHG4 |
| RAT | 289019 | Cdk18 | PCTAIRE-motif protein kinase 3 | Q641Z0 |
| RAT | 289019 | Cdk18 | Cyclin-dependent kinase 18 | O35832 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 18
protein / protein kinase / Cyclin-dependent kinase 18
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 18
protein / transferase / Cyclin-dependent kinase 18
protein / kinase / Cyclin-dependent kinase 18
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 18
protein / protein kinase / Cyclin-dependent kinase 18
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 18
protein / transferase / Cyclin-dependent kinase 18
protein / kinase / Cyclin-dependent kinase 18
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 18
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 18
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx