CDK18
| Description | Cyclin-dependent kinase 18 |
|---|
Gene and Protein Information
| Gene ID | 5129 |
|---|---|
| Uniprot Accession IDs | Q5VXQ2 Q6V3A2 Q6V3A3 Q96F90 |
| Ensembl ID | ENSP00000423665 |
| Symbol | PCTAIRE3 PCTK3 PCTK3 PCTAIRE PCTAIRE3 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 100430417 | CDK18 | cyclin dependent kinase 18 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18557 | Cdk18 | cyclin-dependent kinase 18 | 10090 | MGI:97518 | Inparanoid, OMA, EggNOG |
| Rat | 289019 | Cdk18 | cyclin-dependent kinase 18 | 10116 | RGD:1309523 | Inparanoid, OMA, EggNOG |
| Dog | 488573 | CDK18 | cyclin dependent kinase 18 | 9615 | VGNC:39049 | Inparanoid, OMA, EggNOG |
| Horse | 100050250 | CDK18 | cyclin dependent kinase 18 | 9796 | VGNC:16344 | Inparanoid, OMA, EggNOG |
| Cow | 534048 | CDK18 | cyclin dependent kinase 18 | 9913 | VGNC:27121 | OMA, EggNOG |
| Opossum | 100014165 | CDK18 | cyclin dependent kinase 18 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 771736 | CDK18 | cyclin dependent kinase 18 | 9031 | CGNC:437 | OMA, EggNOG |
| Anole lizard | 100564067 | cdk18 | cyclin dependent kinase 18 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448581 | cdk18 | cyclin-dependent kinase 18 | 8364 | XB-GENE-489094 | OMA, EggNOG |
| Zebrafish | 100150007 | si:dkey-166c18.1 | si:dkey-166c18.1 | 7955 | ZDB-GENE-141215-51 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 18
protein / protein kinase / Cyclin-dependent kinase 18
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 18
protein / transferase / Cyclin-dependent kinase 18
protein / kinase / Cyclin-dependent kinase 18
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 18
protein / protein kinase / Cyclin-dependent kinase 18
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 18
protein / transferase / Cyclin-dependent kinase 18
protein / kinase / Cyclin-dependent kinase 18
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 18
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 18
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|