CTSH
| Description | Pro-cathepsin H |
|---|
Gene and Protein Information
| Gene ID | 1512 |
|---|---|
| Uniprot Accession IDs | B2RBK0 Q96NY6 Q9BUM7 |
| Ensembl ID | ENSP00000220166 |
| Symbol | CPSB ACC4 ACC5 CPSB ACC-4 ACC-5 |
| Family | Belongs to the peptidase C1 family. |
| Sequence | MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740462 | CTSH | cathepsin H | 9598 | VGNC:2480 | OMA, EggNOG |
| Macaque | 711437 | CTSH | cathepsin H | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13036 | Ctsh | cathepsin H | 10090 | MGI:107285 | Inparanoid, OMA, EggNOG |
| Rat | 25425 | Ctsh | cathepsin H | 10116 | RGD:2447 | Inparanoid, OMA, EggNOG |
| Dog | 479065 | CTSH | cathepsin H | 9615 | VGNC:39713 | Inparanoid, OMA, EggNOG |
| Horse | 100059835 | CTSH | cathepsin H | 9796 | VGNC:16952 | Inparanoid, OMA, EggNOG |
| Cow | 510524 | CTSH | cathepsin H | 9913 | VGNC:27816 | Inparanoid, OMA, EggNOG |
| Pig | 396969 | CTSH | cathepsin H | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100014210 | CTSH | cathepsin H | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100561600 | ctsh | cathepsin H | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 324818 | ctsh | cathepsin H | 7955 | ZDB-GENE-030131-3539 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / protease inhibitor / Pro-cathepsin H
protein / cysteine protease / Pro-cathepsin H
protein / protease / Pro-cathepsin H
protein / hydrolase / Pro-cathepsin H
protein / protease inhibitor / Pro-cathepsin H
protein / cysteine protease / Pro-cathepsin H
protein / protease / Pro-cathepsin H
protein / hydrolase / Pro-cathepsin H
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|