Protein or Target Summary
Chromobox protein homolog 1
| Gene ID | 10951 |
|---|---|
| uniprot | P83916 |
| Gene Name | CBX1 |
| Ensernbl ID | ENSP00000377060 |
| Sequence | MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Chromodomain / Chromobox protein homolog 1
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Chromodomain / Chromobox protein homolog 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx