Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CBX1

DescriptionChromobox protein homolog 1

Gene and Protein Information

Gene ID10951
Uniprot Accession IDs P23197
Ensembl ID ENSP00000377060
Symbol CBX CBX M31 MOD1 p25beta HP1-BETA HP1Hsbeta HP1Hs-beta
Sequence
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse12412Cbx1chromobox 110090MGI:105369Inparanoid, OMA, EggNOG
Rat360609Cbx1chromobox 110116RGD:1310714Inparanoid, OMA
Dog491051CBX1chromobox 19615VGNC:38766Inparanoid, OMA
Horse100055567CBX1chromobox 19796VGNC:16097Inparanoid, OMA, EggNOG
Cow616506CBX1chromobox 19913VGNC:26816Inparanoid, OMA, EggNOG
Pig100520403CBX1chromobox 19823OMA, EggNOG
Opossum100018013CBX1chromobox 113616Inparanoid, OMA
Platypus100084218CBX1chromobox 19258Inparanoid, OMA
Anole lizard100560857cbx1chromobox 128377Inparanoid, OMA
Xenopus549904cbx1chromobox 18364XB-GENE-1005974Inparanoid, OMA
Zebrafish415180cbx1bchromobox homolog 1b (HP1 beta homolog Drosophila)7955ZDB-GENE-040625-68Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 1

Associated Recombinant Proteins

The page will load shortly, Thanks for your patience!
NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      dermatomyositis987Expression AtlasMONDO:0016367
      group 3 medulloblastoma7142Expression AtlasMONDO:0007959
      lung cancer4468Expression AtlasMONDO:0008903
      non-small cell lung cancer3141Expression AtlasMONDO:0005233
      ovarian cancer8576Expression AtlasMONDO:0008170
      primary pancreatic ductal adenocarcinoma3122Expression AtlasMONDO:0005184
      Waldenstrons macroglobulinemia770Expression AtlasMONDO:0000432
      Prostatic Neoplasms600CTDMONDO:0008315
      Prostatic Neoplasms0DisGeNET
      Malignant neoplasm of prostate600DisGeNETMONDO:0008315

      Bibliography

      1.Aagaard, L L and 11 more authors. 1999-04-01 Functional mammalian homologues of the Drosophila PEV-modifier Su(var)3-9 encode centromere-associated proteins which complex with the heterochromatin component M31. [PMID:10202156]
      2.Minc, E E, Allory, Y Y, Worman, H J HJ, Courvalin, J C JC and Buendia, B B. 1999-08 Localization and phosphorylation of HP1 proteins during the cell cycle in mammalian cells. [PMID:10460410]
      3.Murzina, N N, Verreault, A A, Laue, E E and Stillman, B B. 1999-10 Heterochromatin dynamics in mouse cells: interaction between chromatin assembly factor 1 and HP1 proteins. [PMID:10549285]
      4.Nielsen, A L AL and 7 more authors. 1999-11-15 Interaction with members of the heterochromatin protein 1 (HP1) family and histone deacetylation are differentially involved in transcriptional silencing by members of the TIF1 family. [PMID:10562550]
      5.Brasher, S V SV and 9 more authors. 2000-04-03 The structure of mouse HP1 suggests a unique mode of single peptide recognition by the shadow chromo domain dimer. [PMID:10747027]
      6.Zhao, T T, Heyduk, T T, Allis, C D CD and Eissenberg, J C JC. 2000-09-08 Heterochromatin protein 1 binds to nucleosomes and DNA in vitro. [PMID:10882726]
      7.Kourmouli, N N and 7 more authors. 2000-12-01 Dynamic associations of heterochromatin protein 1 with the nuclear envelope. [PMID:11101528]
      8.Lachner, M M, O'Carroll, D D, Rea, S S, Mechtler, K K and Jenuwein, T T. 2001-03-01 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins. [PMID:11242053]
      9.Bannister, A J AJ and 6 more authors. 2001-03-01 Selective recognition of methylated lysine 9 on histone H3 by the HP1 chromo domain. [PMID:11242054]
      10.Nielsen, A L AL and 5 more authors. 2001-04 Heterochromatin formation in mammalian cells: interaction between histones and HP1 proteins. [PMID:11336697]