The store will not work correctly when cookies are disabled.
CCL24
| Description | C-C motif chemokine 24 |
|---|
Gene and Protein Information
| Gene ID | 6369 |
|---|
| Uniprot Accession IDs | B2R5K2 |
|---|
| Ensembl ID | ENSP00000400533 |
|---|
| Symbol | MPIF2 SCYA24 Ckb-6 MPIF2 MPIF-2 SCYA24 |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472418 | CCL24 | C-C motif chemokine ligand 24 | 9598 | VGNC:13635 | OMA, EggNOG |
| Mouse | 56221 | Ccl24 | chemokine (C-C motif) ligand 24 | 10090 | MGI:1928953 | Inparanoid, OMA, EggNOG |
| Rat | 288593 | Ccl24 | C-C motif chemokine ligand 24 | 10116 | RGD:1310245 | Inparanoid, OMA, EggNOG |
| Dog | 445452 | CCL24 | C-C motif chemokine ligand 24 | 9615 | VGNC:38886 | Inparanoid, OMA, EggNOG |
| Horse | 100061208 | CCL24 | C-C motif chemokine ligand 24 | 9796 | VGNC:16200 | Inparanoid, OMA, EggNOG |
| Cow | 617258 | CCL24 | C-C motif chemokine ligand 24 | 9913 | VGNC:26950 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
