The store will not work correctly when cookies are disabled.
CCL25
| Description | C-C motif chemokine 25 |
|---|
Gene and Protein Information
| Gene ID | 6370 |
|---|
| Uniprot Accession IDs | A1L4J4 A6NI52 A8K9E7 B5MCA5 Q96KJ7 |
|---|
| Ensembl ID | ENSP00000375086 |
|---|
| Symbol | SCYA25 TECK TECK Ckb15 SCYA25 |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 743059 | CCL25 | C-C motif chemokine ligand 25 | 9598 | VGNC:11951 | OMA, EggNOG |
| Macaque | 574219 | CCL25 | C-C motif chemokine ligand 25 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20300 | Ccl25 | chemokine (C-C motif) ligand 25 | 10090 | MGI:1099448 | Inparanoid, EggNOG |
| Rat | 360750 | Ccl25 | C-C motif chemokine ligand 25 | 10116 | RGD:1305530 | Inparanoid, OMA, EggNOG |
| Dog | 448798 | CCL25 | C-C motif chemokine ligand 25 | 9615 | VGNC:38887 | Inparanoid, OMA, EggNOG |
| Horse | 100066885 | CCL25 | C-C motif chemokine ligand 25 | 9796 | VGNC:16201 | Inparanoid, OMA, EggNOG |
| Cow | 615986 | CCL25 | C-C motif chemokine ligand 25 | 9913 | VGNC:26951 | Inparanoid, OMA, EggNOG |
| Pig | 448799 | CCL25 | C-C motif chemokine ligand 25 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 103102658 | CCL25 | C-C motif chemokine ligand 25 | 13616 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
