JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

CCL25

Description	C-C motif chemokine 25

Gene and Protein Information

Gene ID	6370
Uniprot Accession IDs	A1L4J4 A6NI52 A8K9E7 B5MCA5 Q96KJ7
Ensembl ID	ENSP00000375086
Symbol	SCYA25 TECK TECK Ckb15 SCYA25
Family	Belongs to the intercrine beta (chemokine CC) family.
Sequence	MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	743059	CCL25	C-C motif chemokine ligand 25	9598	VGNC:11951	OMA, EggNOG
Macaque	574219	CCL25	C-C motif chemokine ligand 25	9544		Inparanoid, OMA, EggNOG
Mouse	20300	Ccl25	chemokine (C-C motif) ligand 25	10090	MGI:1099448	Inparanoid, EggNOG
Rat	360750	Ccl25	C-C motif chemokine ligand 25	10116	RGD:1305530	Inparanoid, OMA, EggNOG
Dog	448798	CCL25	C-C motif chemokine ligand 25	9615	VGNC:38887	Inparanoid, OMA, EggNOG
Horse	100066885	CCL25	C-C motif chemokine ligand 25	9796	VGNC:16201	Inparanoid, OMA, EggNOG
Cow	615986	CCL25	C-C motif chemokine ligand 25	9913	VGNC:26951	Inparanoid, OMA, EggNOG
Pig	448799	CCL25	C-C motif chemokine ligand 25	9823		Inparanoid, OMA, EggNOG
Opossum	103102658	CCL25	C-C motif chemokine ligand 25	13616		Inparanoid, EggNOG

PANTHER Classes
protein / signaling molecule / chemokine / C-C motif chemokine 25

DTO Classes
protein / Signaling / Chemokine / C-C motif chemokine 25

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source