The store will not work correctly when cookies are disabled.
CCL15
| Description | C-C motif chemokine 15 |
|---|
Gene and Protein Information
| Gene ID | 6359 |
|---|
| Uniprot Accession IDs | B2RU34 E1P651 Q9UM74 |
|---|
| Ensembl ID | ENSP00000484078 |
|---|
| Symbol | MIP5 NCC3 SCYA15 LKN1 NCC3 SY15 HCC-2 LKN-1 MIP-5 NCC-3 SCYL3 MIP-1D MRP-2B SCYA15 HMRP-2B MIP-1 delta |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
