The store will not work correctly when cookies are disabled.
CCND3
Description | G1/S-specific cyclin-D3 |
---|
Gene and Protein Information
Gene ID | 896 |
Uniprot Accession IDs | B2RD63 B3KQ22 E9PAS4 E9PB36 Q5T8J0 Q6FG62 Q96F49 |
Ensembl ID | ENSP00000362082 |
Family | Belongs to the cyclin family. Cyclin D subfamily. |
Sequence | MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 462689 | CCND3 | cyclin D3 | 9598 | VGNC:11040 | OMA, EggNOG |
Macaque | 695215 | CCND3 | cyclin D3 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 12445 | Ccnd3 | cyclin D3 | 10090 | MGI:88315 | Inparanoid, OMA, EggNOG |
Rat | 25193 | Ccnd3 | cyclin D3 | 10116 | RGD:2293 | Inparanoid, OMA, EggNOG |
Dog | 608847 | CCND3 | cyclin D3 | 9615 | VGNC:54284 | Inparanoid, OMA |
Horse | 100066590 | CCND3 | cyclin D3 | 9796 | VGNC:16209 | Inparanoid, OMA |
Cow | 540547 | CCND3 | cyclin D3 | 9913 | VGNC:26964 | Inparanoid, OMA |
Opossum | 100027538 | CCND3 | cyclin D3 | 13616 | | Inparanoid, OMA |
Chicken | 419928 | CCND3 | cyclin D3 | 9031 | CGNC:2542 | Inparanoid, OMA |
Anole lizard | 100566165 | ccnd3 | cyclin D3 | 28377 | | Inparanoid, OMA |
C. elegans | 174941 | cyd-1 | G1/S-specific cyclin-D | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|