The store will not work correctly when cookies are disabled.
CEACAM3
| Description | Carcinoembryonic antigen-related cell adhesion molecule 3 |
|---|
Gene and Protein Information
| Gene ID | 1084 |
|---|
| Uniprot Accession IDs | G5E978 Q3KPH9 |
|---|
| Ensembl ID | ENSP00000349971 |
|---|
| Symbol | CD66D CGM1 CEA CGM1 W264 W282 CD66D |
|---|
| Family | Belongs to the immunoglobulin superfamily. CEA family. |
|---|
| Sequence | MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Dog | 100049000 | CEACAM24 | carcinoembryonic antigen-related cell adhesion molecule 24 | 9615 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
