Protein or Target Summary

Cyclin-dependent kinase-like 1

Gene ID	8814
uniprot	Q00532
Gene Name	CDKL1
Ensernbl ID	ENSP00000379176
Family	Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence	MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	8814	CDKL1	Cyclin-dependent kinase-like 1	Q00532
MOUSE	71091	Cdkl1	Cyclin-dependent kinase-like 1	Q8CEQ0
MOUSE	71091	Cdkl1	Cyclin-dependent kinase-like 1 (CDC2-related kinase)	Q14BG3
RAT	314198	Cdkl1	Cyclin-dependent kinase-like 1	Q66HE7

Protein Classes

PANTHER Classes
protein    /    non-receptor serine/threonine protein kinase    /    Cyclin-dependent kinase-like 1
protein    /    protein kinase    /    Cyclin-dependent kinase-like 1
protein    /    non-receptor tyrosine protein kinase    /    Cyclin-dependent kinase-like 1
protein    /    transferase    /    Cyclin-dependent kinase-like 1
protein    /    kinase    /    Cyclin-dependent kinase-like 1

DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDKL family / Cyclin-dependent kinase-like 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx