CDKL1
| Description | Cyclin-dependent kinase-like 1 |
|---|
Gene and Protein Information
| Gene ID | 8814 |
|---|---|
| Uniprot Accession IDs | J3KMW1 Q2M3A4 Q6QUA0 Q8WXQ5 |
| Ensembl ID | ENSP00000379176 |
| Symbol | P42 KKIALRE |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100610829 | CDKL1 | cyclin dependent kinase like 1 | 9598 | VGNC:7437 | OMA, EggNOG |
| Macaque | 705975 | CDKL1 | cyclin dependent kinase like 1 | 9544 | OMA, EggNOG | |
| Mouse | 71091 | Cdkl1 | cyclin-dependent kinase-like 1 (CDC2-related kinase) | 10090 | MGI:1918341 | Inparanoid, OMA, EggNOG |
| Rat | 314198 | Cdkl1 | cyclin dependent kinase like 1 | 10116 | RGD:1305080 | Inparanoid, OMA, EggNOG |
| Dog | 480317 | CDKL1 | cyclin dependent kinase like 1 | 9615 | VGNC:39064 | Inparanoid, OMA |
| Horse | 100066398 | CDKL1 | cyclin dependent kinase like 1 | 9796 | VGNC:16359 | Inparanoid, OMA, EggNOG |
| Cow | 523900 | CDKL1 | cyclin dependent kinase like 1 | 9913 | VGNC:27138 | Inparanoid, OMA |
| Platypus | 100078025 | CDKL1 | cyclin dependent kinase like 1 | 9258 | Inparanoid, OMA | |
| Chicken | 423575 | CDKL1 | cyclin dependent kinase like 1 | 9031 | CGNC:51997 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562457 | cdkl1 | cyclin dependent kinase like 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100496578 | cdkl1 | cyclin dependent kinase like 1 | 8364 | XB-GENE-6051219 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445316 | cdkl1 | cyclin-dependent kinase-like 1 (CDC2-related kinase) | 7955 | ZDB-GENE-040808-34 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase-like 1
protein / protein kinase / Cyclin-dependent kinase-like 1
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase-like 1
protein / transferase / Cyclin-dependent kinase-like 1
protein / kinase / Cyclin-dependent kinase-like 1
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase-like 1
protein / protein kinase / Cyclin-dependent kinase-like 1
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase-like 1
protein / transferase / Cyclin-dependent kinase-like 1
protein / kinase / Cyclin-dependent kinase-like 1
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDKL family / Cyclin-dependent kinase-like 1
protein / Kinase / Protein kinase / CMGC group / CDKL family / Cyclin-dependent kinase-like 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|