The store will not work correctly when cookies are disabled.
CDK5R1
| Description | Cyclin-dependent kinase 5 activator 1 |
|---|
Gene and Protein Information
| Gene ID | 8851 |
|---|
| Uniprot Accession IDs | E1P664 Q5U0G3 CDK5 activator 1 |
|---|
| Ensembl ID | ENSP00000318486 |
|---|
| Symbol | CDK5R NCK5A p23 p25 p35 CDK5R NCK5A CDK5P35 p35nck5a |
|---|
| Family | Belongs to the cyclin-dependent kinase 5 activator family. |
|---|
| Sequence | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 747897 | CDK5R1 | cyclin dependent kinase 5 regulatory subunit 1 | 9598 | VGNC:12050 | OMA, EggNOG |
| Macaque | 714274 | CDK5R1 | cyclin dependent kinase 5 regulatory subunit 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12569 | Cdk5r1 | cyclin-dependent kinase 5, regulatory subunit 1 (p35) | 10090 | MGI:101764 | Inparanoid, OMA, EggNOG |
| Rat | 116671 | Cdk5r1 | cyclin-dependent kinase 5 regulatory subunit 1 | 10116 | RGD:629472 | Inparanoid, OMA, EggNOG |
| Dog | 491154 | CDK5R1 | cyclin dependent kinase 5 regulatory subunit 1 | 9615 | VGNC:39055 | Inparanoid, OMA, EggNOG |
| Horse | 100071764 | CDK5R1 | cyclin dependent kinase 5 regulatory subunit 1 | 9796 | VGNC:16350 | Inparanoid, OMA, EggNOG |
| Cow | 282173 | CDK5R1 | cyclin dependent kinase 5 regulatory subunit 1 | 9913 | VGNC:27128 | Inparanoid, OMA, EggNOG |
| Pig | | CDK5R1 | cyclin dependent kinase 5 regulatory subunit 1 [Source:HGNC Symbol;Acc:HGNC:1775] | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100018527 | CDK5R1 | cyclin dependent kinase 5 regulatory subunit 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567431 | cdk5r1 | cyclin dependent kinase 5 regulatory subunit 1 | 28377 | | Inparanoid, EggNOG |
| Xenopus | 100497533 | cdk5r1 | cyclin-dependent kinase 5, regulatory subunit 1 (p35) | 8364 | XB-GENE-1032903 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436788 | cdk5r1b | cyclin-dependent kinase 5, regulatory subunit 1b (p35) | 7955 | ZDB-GENE-040718-220 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
