Protein or Target Summary
Cyclin-dependent kinase 5 activator 1
| Gene ID | 8851 |
|---|---|
| uniprot | Q15078 |
| Gene Name | CDK5R1 |
| Ensernbl ID | ENSP00000318486 |
| Family | Belongs to the cyclin-dependent kinase 5 activator family. |
| Sequence | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 8851 | CDK5R1 | Cyclin-dependent kinase 5 activator 1 | Q15078 |
| MOUSE | 12569 | Cdk5r1 | Cyclin-dependent kinase 5 activator 1 | P61809 |
| MOUSE | Cdk5r1 | Cyclin-dependent kinase 5 activator | Q8BJD8 | |
| MOUSE | Cdk5r1 | Cyclin-dependent kinase 5 activator 1 | B1AQH0 | |
| MOUSE | Cdk5r1 | Cyclin-dependent kinase 5 activator | Q8BKY0 | |
| MOUSE | Cdk5r1 | Cyclin-dependent kinase 5 activator | Q3V3I8 | |
| MOUSE | Cdk5r1 | Cyclin-dependent kinase 5 activator | Q8BLT0 | |
| MOUSE | 12569 | Cdk5r1 | Cyclin-dependent kinase 5 activator | Q542T9 |
| RAT | 116671 | Cdk5r1 | Cyclin-dependent kinase 5 activator 1 | P61810 |
Protein Classes
PANTHER Classes
protein / enzyme modulator / kinase activator / Cyclin-dependent kinase 5 activator 1
protein / enzyme modulator / kinase activator / Cyclin-dependent kinase 5 activator 1
DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / Cyclin-dependent kinase 5 activator 1
protein / Enzyme modulator / Kinase modulator / Kinase activator / Cyclin-dependent kinase 5 activator 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx