Protein or Target Summary

Corticosteroid 11-beta-dehydrogenase isozyme 2

Gene ID	3291
uniprot	P80365
Gene Name	HSD11B2
Ensernbl ID	ENSP00000316786
Family	Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence	MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3291	HSD11B2	Corticosteroid 11-beta-dehydrogenase isozyme 2	P80365
MOUSE	15484	Hsd11b2	Corticosteroid 11-beta-dehydrogenase isozyme 2	P51661
MOUSE	15484	Hsd11b2	Hsd11b2 protein	Q6NZB9
MOUSE		Hsd11b2	Uncharacterized protein	Q3U2R0
RAT	25117	Hsd11b2	Corticosteroid 11-beta-dehydrogenase isozyme 2	P50233
RAT		Hsd11b2	Corticosteroid 11-beta-dehydrogenase isozyme 2	A0A1B0GWP2

Protein Classes

PANTHER Classes
protein / oxidoreductase / dehydrogenase / Corticosteroid 11-beta-dehydrogenase isozyme 2
protein / oxidoreductase / reductase / Corticosteroid 11-beta-dehydrogenase isozyme 2

DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / Corticosteroid 11-beta-dehydrogenase isozyme 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx