The store will not work correctly when cookies are disabled.
QDPR
| Description | Dihydropteridine reductase |
|---|
Gene and Protein Information
| Gene ID | 5860 |
|---|
| Uniprot Accession IDs | A8K158 B3KW71 Q53F52 Q9H3M5 |
|---|
| Ensembl ID | ENSP00000281243 |
|---|
| Symbol | DHPR SDR33C1 DHPR PKU2 HDHPR SDR33C1 |
|---|
| Family | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
|---|
| Sequence | MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 745779 | QDPR | quinoid dihydropteridine reductase | 9598 | VGNC:741 | OMA, EggNOG |
| Macaque | 714966 | QDPR | quinoid dihydropteridine reductase | 9544 | | OMA, EggNOG |
| Mouse | 110391 | Qdpr | quinoid dihydropteridine reductase | 10090 | MGI:97836 | Inparanoid, OMA, EggNOG |
| Rat | 64192 | Qdpr | quinoid dihydropteridine reductase | 10116 | RGD:619915 | Inparanoid, OMA, EggNOG |
| Dog | 479082 | QDPR | quinoid dihydropteridine reductase | 9615 | VGNC:45231 | Inparanoid, OMA, EggNOG |
| Horse | 100068697 | QDPR | quinoid dihydropteridine reductase | 9796 | VGNC:22070 | Inparanoid, OMA, EggNOG |
| Cow | 618084 | QDPR | quinoid dihydropteridine reductase | 9913 | VGNC:33596 | Inparanoid, OMA, EggNOG |
| Opossum | 100015089 | QDPR | quinoid dihydropteridine reductase | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100074628 | QDPR | quinoid dihydropteridine reductase | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100554746 | qdpr | quinoid dihydropteridine reductase | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 496990 | qdpr | quinoid dihydropteridine reductase | 8364 | XB-GENE-968579 | Inparanoid, OMA, EggNOG |
| Zebrafish | 791448 | qdprb1 | quinoid dihydropteridine reductase b1 | 7955 | ZDB-GENE-050522-320 | Inparanoid, OMA, EggNOG |
| C. elegans | 176762 | qdpr-1 | Quinoid DihydroPteridine Reductase | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 39050 | Dhpr | Dihydropteridine reductase | 7227 | FBgn0035964 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
