JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
GJB7

GJB7

Description	Gap junction beta-7 protein

Gene and Protein Information

Gene ID	375519
Uniprot Accession IDs	B3KXL0 Q96KP0
Ensembl ID	ENSP00000435355
Symbol	CX25 CX25 bA136M9.1 connexin25
Family	Belongs to the connexin family. Beta-type (group I) subfamily.
Sequence	MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Horse	100070584	GJB7	gap junction protein beta 7	9796	VGNC:51032	Inparanoid, OMA
Opossum	100025224	GJB7	gap junction protein beta 7	13616		Inparanoid, OMA
Xenopus	100488401	gjb7	gap junction protein beta 7	8364	XB-GENE-965093	Inparanoid, OMA
Zebrafish	566668	cx28.8	connexin 28.8	7955	ZDB-GENE-050616-1	Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / cell junction protein / gap junction / Gap junction beta-7 protein

DTO Classes
protein / Cell-cell junction / Gap junction / Gap junction beta-7 protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]