JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

DCN1-like protein 1

Gene ID	54165
uniprot	Q96GG9
Gene Name	DCUN1D1
Ensernbl ID	ENSP00000292782
Sequence	MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	54165	DCUN1D1	DCN1-like protein 1	Q96GG9
MOUSE	114893	Dcun1d1	DCN1-like protein 1	Q9QZ73
MOUSE		Dcun1d1	DCN1-like protein 1	A0A0G2JFP2
MOUSE		Dcun1d1	DCN1-like protein	A0A0G2JGV7
MOUSE		Dcun1d1	DCN1-like protein	A0A1B0GXL7
MOUSE		Dcun1d1	DCN1-like protein	A0A140T8R8
MOUSE		Dcun1d1	DCN1-like protein	A0A0G2JDN9
MOUSE		Dcun1d1	DCN1-like protein	A0A0G2JDM0
MOUSE		Dcun1d1	DCN1-like protein	A0A0G2JEA2
MOUSE	114893	Dcun1d1	DCN1-like protein	Q3UT23
RAT	310324	Dcun1d1	DCN1-like protein	A0A0G2K8D6
RAT	310324	Dcun1d1	DCN1-like protein	D3ZRV0

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx