The store will not work correctly when cookies are disabled.
PDF
| Description | Peptide deformylase, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 64146 |
|---|
| Uniprot Accession IDs | Q8WUN6 |
|---|
| Ensembl ID | ENSP00000288022 |
|---|
| Symbol | PDF1A |
|---|
| Family | Belongs to the polypeptide deformylase family. |
|---|
| Sequence | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Rat | 690214 | Pdf | peptide deformylase (mitochondrial) | 10116 | RGD:1582894 | Inparanoid, OMA, EggNOG |
| Dog | 610955 | PDF | peptide deformylase, mitochondrial | 9615 | VGNC:49608 | Inparanoid, OMA, EggNOG |
| Cow | 788473 | PDF | peptide deformylase, mitochondrial | 9913 | VGNC:49562 | Inparanoid, OMA, EggNOG |
| Opossum | 100027986 | PDF | peptide deformylase, mitochondrial | 13616 | | Inparanoid, EggNOG |
| Anole lizard | 100560353 | pdf | peptide deformylase, mitochondrial | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 448425 | pdf | peptide deformylase, mitochondrial | 8364 | XB-GENE-1010345 | Inparanoid, OMA, EggNOG |
| Zebrafish | 619248 | pdf | peptide deformylase, mitochondrial | 7955 | ZDB-GENE-050913-42 | Inparanoid, OMA, EggNOG |
| Fruitfly | 318700 | CG31373 | CG31373 gene product from transcript CG31373-RA | 7227 | FBgn0051373 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
