The store will not work correctly when cookies are disabled.
Protein or Target Summary
Peptide deformylase, mitochondrial
| Gene ID | 64146 |
|---|
| uniprot | Q9HBH1 |
|---|
| Gene Name | PDF |
|---|
| Ensernbl ID | ENSP00000288022 |
|---|
| Family | Belongs to the polypeptide deformylase family. |
|---|
| Sequence | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 64146 | PDF | Peptide deformylase, mitochondrial | Q9HBH1 |
| MOUSE | | Pdf | Peptide deformylase (mitochondrial) | S4R2R8 |
| MOUSE | 68023 | Pdf | Peptide deformylase | S4R2K0 |
| RAT | | Pdf | Peptide deformylase | F1LVY9 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
