The store will not work correctly when cookies are disabled.
DEFB1
| Description | Beta-defensin 1 |
|---|
Gene and Protein Information
| Gene ID | 1672 |
|---|
| Uniprot Accession IDs | Q09753 BD-1 |
|---|
| Ensembl ID | ENSP00000297439 |
|---|
| Symbol | BD1 HBD1 BD1 HBD1 DEFB-1 DEFB101 |
|---|
| Family | Belongs to the beta-defensin family. |
|---|
| Sequence | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
