Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

DGAT2

DescriptionDiacylglycerol O-acyltransferase 2

Gene and Protein Information

Gene ID84649
Uniprot Accession IDs A6ND76 Q5U810 Q68CL3 Q68DJ0 Q8NDB7 Q96BS0 Q9BYE5
Ensembl ID ENSP00000228027
Symbol ARAT HMFN1045 GS1999FULL
FamilyBelongs to the diacylglycerol acyltransferase family.
Sequence
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp466714DGAT2diacylglycerol O-acyltransferase 29598VGNC:3134OMA, EggNOG
Macaque696549DGAT2diacylglycerol O-acyltransferase 29544OMA, EggNOG
Mouse67800Dgat2diacylglycerol O-acyltransferase 210090MGI:1915050Inparanoid, OMA, EggNOG
Rat252900Dgat2diacylglycerol O-acyltransferase 210116RGD:620329Inparanoid, OMA, EggNOG
Dog485185DGAT2diacylglycerol O-acyltransferase 29615VGNC:39913Inparanoid, OMA, EggNOG
HorseDGAT2diacylglycerol O-acyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:16940]9796OMA, EggNOG
Cow404129DGAT2diacylglycerol O-acyltransferase 29913VGNC:28021Inparanoid, OMA, EggNOG
Opossum100011089DGAT2diacylglycerol O-acyltransferase 213616Inparanoid, OMA, EggNOG
Anole lizard100552736dgat2diacylglycerol O-acyltransferase 228377Inparanoid, OMA, EggNOG
Xenopus395003dgat2diacylglycerol O-acyltransferase 28364XB-GENE-1017054Inparanoid, OMA, EggNOG
Zebrafish565316dgat2diacylglycerol O-acyltransferase 27955ZDB-GENE-050913-15Inparanoid, OMA, EggNOG
S.cerevisiae854419DGA1diacylglycerol O-acyltransferase4932S000005771OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    acyltransferase    /    Diacylglycerol O-acyltransferase 2
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Diacylglycerol O-acyltransferase 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.