Protein or Target Summary
HLA class II histocompatibility antigen, DM beta chain
| Gene ID | 3109 |
|---|---|
| uniprot | P28068 |
| Gene Name | HLA-DMB |
| Ensernbl ID | ENSP00000398890 |
| Family | Belongs to the MHC class II family. |
| Sequence | MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / defense/immunity protein / major histocompatibility complex antigen / HLA class II histocompatibility antigen, DM beta chain
protein / defense/immunity protein / major histocompatibility complex antigen / HLA class II histocompatibility antigen, DM beta chain
DTO Classes
protein / Immune response / Major histocompatibility complex antigen / HLA class II histocompatibility antigen, DM beta chain
protein / Immune response / Major histocompatibility complex antigen / HLA class II histocompatibility antigen, DM beta chain
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx