Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Cytochrome c

Gene ID54205
uniprotP99999
Gene NameCYCS
Ensernbl IDENSP00000307786
FamilyBelongs to the cytochrome c family.
Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN54205CYCSCytochrome cP99999
MOUSE13063CycsCytochrome c, somaticP62897
MOUSE13063CycsCytochrome cQ56A15
RAT25309CycsCytochrome c, somaticP62898

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source