The store will not work correctly when cookies are disabled.
Protein or Target Summary
T-cell surface glycoprotein CD5
| Gene ID | 921 |
|---|
| uniprot | P06127 |
|---|
| Gene Name | CD5 |
|---|
| Ensernbl ID | ENSP00000342681 |
|---|
| Sequence | MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 921 | CD5 | T-cell surface glycoprotein CD5 | P06127 |
| MOUSE | 12507 | Cd5 | T-cell surface glycoprotein CD5 | P13379 |
| MOUSE | | Cd5 | CD5.1 | Q9ER20 |
| MOUSE | 12507 | Cd5 | Uncharacterized protein | Q3UP78 |
| MOUSE | | Cd5 | Uncharacterized protein | Q8C9H0 |
| MOUSE | | Cd5 | CD5 antigen | Q91X69 |
| RAT | 54236 | Cd5 | T-cell surface glycoprotein CD5 | P51882 |
| RAT | | Cd5 | Cd5 protein | Q4KLZ9 |
| RAT | | Cd5 | T-cell surface glycoprotein CD5 | A0A0G2K560 |
| RAT | | Cd5 | CD5 antigen, isoform CRA_b | A0A0G2JX39 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
