JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

྾

CD5

Description	T-cell surface glycoprotein CD5

Gene and Protein Information

Gene ID	921
Uniprot Accession IDs	P06127 A0N0P4 A8K9I3
Ensembl ID	ENSP00000342681
Symbol	LEU1 T1 LEU1
Sequence	MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	737721	CD5	CD5 molecule	9598	VGNC:3157	OMA, EggNOG
Macaque	695249	CD5	CD5 molecule	9544		Inparanoid, OMA, EggNOG
Mouse	12507	Cd5	CD5 antigen	10090	MGI:88340	Inparanoid, OMA, EggNOG
Rat	54236	Cd5	Cd5 molecule	10116	RGD:2309	OMA, EggNOG
Rat	100911215	LOC100911215	T-cell surface glycoprotein CD5-like	10116	RGD:6494271	Inparanoid, OMA
Dog	612338	CD5	CD5 molecule	9615	VGNC:38962	Inparanoid, OMA, EggNOG
Horse	100062143	CD5	CD5 molecule	9796	VGNC:16271	Inparanoid, OMA, EggNOG
Cow	280745	CD5	CD5 molecule	9913	VGNC:27037	Inparanoid, OMA, EggNOG
Pig	100513336	CD5	CD5 molecule	9823		OMA, EggNOG
Opossum	103105389	CD5	CD5 molecule	13616		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

A total of 20 itemsPrev12 NextTopage

Name	Direct Associated Targets	Disease Type	Mondoid
cutaneous lupus erythematosus	1094	Expression Atlas	MONDO:0005282
interstitial cystitis	2307	Expression Atlas	MONDO:0018301
intraductal papillary-mucinous adenoma (IPMA)	2987	Expression Atlas	MONDO:0004381
osteosarcoma	7970	Expression Atlas	MONDO:0009807
psoriasis	6696	Expression Atlas	MONDO:0005083
Arthritis, Rheumatoid	974	CTD	MONDO:0008383
Leukemia, Lymphocytic, Chronic, B-Cell	479	CTD	MONDO:0004948
b-cell chronic lymphocytic leukemia	479	eRAM	MONDO:0004948
rheumatoid arthritis	974	eRAM	MONDO:0008383
Rheumatoid Arthritis	974	DisGeNET	MONDO:0008383

A total of 93 itemsPrev12 3 4 5…10 NextTopage

The page will load shortly, Thanks for your patience!