Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

B-cell antigen receptor complex-associated protein alpha chain

Gene ID973
uniprotP11912
Gene NameCD79A
Ensernbl IDENSP00000221972
Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN973CD79AB-cell antigen receptor complex-associated protein alpha chainP11912
MOUSE12518Cd79aB-cell antigen receptor complex-associated protein alpha chainP11911
RATCd79aUncharacterized proteinF1MAC3

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein alpha chain
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source