CD79A

DescriptionB-cell antigen receptor complex-associated protein alpha chain

Gene and Protein Information

Gene ID973
Uniprot Accession IDs A0N775 Q53FB8
Ensembl ID ENSP00000221972
Symbol IGA MB1 IGA MB-1
Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp740560CD79ACD79a molecule9598VGNC:3643OMA, EggNOG
Mouse12518Cd79aCD79A antigen (immunoglobulin-associated alpha)10090MGI:101774Inparanoid, OMA, EggNOG
Rat100913063Cd79aCD79a molecule10116RGD:6484896OMA, EggNOG
Dog484483CD79ACD79a molecule9615VGNC:38973Inparanoid, OMA, EggNOG
Horse100052219CD79ACD79a molecule9796VGNC:16279Inparanoid, OMA, EggNOG
Cow281674CD79ACD79a molecule9913VGNC:27046Inparanoid, OMA, EggNOG
Anole lizard103282538cd79aCD79a molecule28377Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein alpha chain
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source