Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Signal transducer CD24

Gene ID100133941
uniprotP25063
Gene NameCD24
Ensernbl IDENSP00000483985
FamilyBelongs to the CD24 family.
Sequence
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN100133941CD24Signal transducer CD24P25063
MOUSE12484Cd24Signal transducer CD24P24807
RAT25145Cd24Signal transducer CD24Q07490

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source