The store will not work correctly when cookies are disabled.
CD24
| Description | Signal transducer CD24 |
|---|
Gene and Protein Information
| Gene ID | 100133941 |
|---|
| Uniprot Accession IDs | A0A087WYI6 B6EC88 Q16257 Q53XS0 R4I4T5 |
|---|
| Ensembl ID | ENSP00000483985 |
|---|
| Symbol | CD24A CD24A |
|---|
| Family | Belongs to the CD24 family. |
|---|
| Sequence | MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
