Protein or Target Summary
Cyclin-dependent kinase 17
| Gene ID | 5128 |
|---|---|
| uniprot | Q00537 |
| Gene Name | CDK17 |
| Ensernbl ID | ENSP00000261211 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5128 | CDK17 | Cyclin-dependent kinase 17 | Q00537 |
| MOUSE | 237459 | Cdk17 | Cyclin-dependent kinase 17 | Q8K0D0 |
| MOUSE | Cdk17 | Pctk2 protein | I6L9D3 | |
| MOUSE | Cdk17 | Uncharacterized protein | Q8C5H7 | |
| MOUSE | Cdk17 | Cyclin-dependent kinase 17 | A0A1L1SR36 | |
| MOUSE | Cdk17 | Cyclin-dependent kinase 17 | A0A1L1SUA6 | |
| MOUSE | Cdk17 | Cyclin-dependent kinase 17 | A0A1L1SUS7 | |
| MOUSE | Cdk17 | Cyclin-dependent kinase 17 | A0A1L1SSL3 | |
| MOUSE | Cdk17 | Pctaire2 transcript variant a | C7C6B5 | |
| MOUSE | Cdk17 | Pctaire2 transcript variant b | C7C6B6 | |
| RAT | Cdk17 | Cyclin-dependent kinase 17 | O35831 | |
| RAT | 314743 | Cdk17 | Cyclin-dependent kinase 17 | G3V6J5 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 17
protein / protein kinase / Cyclin-dependent kinase 17
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 17
protein / transferase / Cyclin-dependent kinase 17
protein / kinase / Cyclin-dependent kinase 17
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 17
protein / protein kinase / Cyclin-dependent kinase 17
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 17
protein / transferase / Cyclin-dependent kinase 17
protein / kinase / Cyclin-dependent kinase 17
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 17
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 17
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx