CDK17
Description | Cyclin-dependent kinase 17 |
---|
Gene and Protein Information
Gene ID | 5128 |
---|---|
Uniprot Accession IDs | A8K1U6 B2RCQ2 Q8NEB8 |
Ensembl ID | ENSP00000261211 |
Symbol | PCTAIRE2 PCTK2 PCTK2 PCTAIRE2 |
Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
Sequence | MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF Show more |
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 452146 | CDK17 | cyclin dependent kinase 17 | 9598 | VGNC:8363 | OMA, EggNOG |
Macaque | 717183 | CDK17 | cyclin dependent kinase 17 | 9544 | Inparanoid, OMA, EggNOG | |
Mouse | 237459 | Cdk17 | cyclin-dependent kinase 17 | 10090 | MGI:97517 | Inparanoid, OMA, EggNOG |
Rat | 314743 | Cdk17 | cyclin-dependent kinase 17 | 10116 | RGD:1565593 | Inparanoid, OMA, EggNOG |
Horse | 100065667 | CDK17 | cyclin dependent kinase 17 | 9796 | VGNC:16343 | Inparanoid, OMA, EggNOG |
Cow | 539655 | CDK17 | cyclin dependent kinase 17 | 9913 | VGNC:27120 | Inparanoid, OMA, EggNOG |
Pig | 100622337 | CDK17 | cyclin dependent kinase 17 | 9823 | Inparanoid, OMA, EggNOG | |
Opossum | 100012745 | CDK17 | cyclin dependent kinase 17 | 13616 | Inparanoid, OMA, EggNOG | |
Platypus | CDK17 | cyclin dependent kinase 17 [Source:HGNC Symbol;Acc:HGNC:8750] | 9258 | OMA, EggNOG | ||
Chicken | 417920 | CDK17 | cyclin dependent kinase 17 | 9031 | CGNC:8707 | Inparanoid, OMA, EggNOG |
Anole lizard | 100558014 | cdk17 | cyclin dependent kinase 17 | 28377 | Inparanoid, OMA, EggNOG | |
Xenopus | 100101773 | cdk17 | cyclin-dependent kinase 17 | 8364 | XB-GENE-920552 | Inparanoid, OMA, EggNOG |
Zebrafish | 798487 | cdk17 | cyclin-dependent kinase 17 | 7955 | ZDB-GENE-041210-15 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 17
protein / protein kinase / Cyclin-dependent kinase 17
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 17
protein / transferase / Cyclin-dependent kinase 17
protein / kinase / Cyclin-dependent kinase 17
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 17
protein / protein kinase / Cyclin-dependent kinase 17
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 17
protein / transferase / Cyclin-dependent kinase 17
protein / kinase / Cyclin-dependent kinase 17
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 17
protein / Kinase / Protein kinase / CMGC group / CDK family / TAIRE subfamily / Cyclin-dependent kinase 17
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|